Cpne7 Antibody - C-terminal region (ARP55051_P050)

• Product Number: ARP55051_P050
• Name: Cpne7 Antibody - C-terminal region (ARP55051_P050)
• Protein Size (# AA): 557 amino acids
• Molecular Weight: 61kDa
• NCBI Gene Id: 102278
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Copine VII
• Alias Symbols: AW047065
• Peptide Sequence: Synthetic peptide located within the following region: GARIPPKYEVSHDFAINFNPEDDECEGIQGVVEAYQNCLPKVQLYGPTNV
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Cpne7 (ARP55051_P050) antibody is Catalog # AAP55051 (Previous Catalog # AAPP41610)
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Uniprot ID: Q0VE82
• Protein Name: Copine-7
• Protein Accession #: NP_733785
• Purification: Affinity Purified
• Nucleotide Accession #: NM_170684
• Tested Species Reactivity: Mouse
• Gene Symbol: Cpne7
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 90%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 100%
• Image 1: Mouse Brain
  
  WB Suggested Anti-Cpne7 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: Mouse Brain