| Product Number |
ARP54991_P050 |
| Product Page |
www.avivasysbio.com/1110067d22rik-antibody-middle-region-arp54991-p050.html |
| Name |
Lgalsl Antibody - middle region (ARP54991_P050) |
| Protein Size (# AA) |
172 amino acids |
| Molecular Weight |
19kDa |
| NCBI Gene Id |
216551 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RIKEN cDNA 1110067D22 gene |
| Alias Symbols |
Grpa, Hspc159, Lgalsla, A530071M23, 1110067D22Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: CGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQ |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
1110067D22Rik does not bind lactose, and may not bind carbohydrates. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Lgalsl (ARP54991_P050) antibody |
| Blocking Peptide |
For anti-Lgalsl (ARP54991_P050) antibody is Catalog # AAP54991 (Previous Catalog # AAPP32252) |
| Uniprot ID |
Q8VED9 |
| Protein Name |
Galectin-related protein A |
| Protein Accession # |
NP_776113 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_173752 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Lgalsl |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Mouse Brain
 | WB Suggested Anti-1110067D22Rik Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Brain |
|
|
