MRPL13 Antibody - middle region (ARP54978_P050)

Data Sheet
 
Product Number ARP54978_P050
Product Page www.avivasysbio.com/mrpl13-antibody-middle-region-arp54978-p050.html
Name MRPL13 Antibody - middle region (ARP54978_P050)
Protein Size (# AA) 178 amino acids
Molecular Weight 21kDa
NCBI Gene Id 28998
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Mitochondrial ribosomal protein L13
Alias Symbols L13, L13A, L13mt, RPL13, RPML13
Peptide Sequence Synthetic peptide located within the following region: AIYGMLPKNLHRRTMMERLHLFPDEYIPEDILKNLVEELPQPRKIPKRLD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein.
Protein Interactions FN1; MRPL55; MRPL10; MRPL52; MRPL45; MRPL24; MRPL44; MRPL9; MRPL11; MRPL38; MRPL41; MRPS9; MRPL14; MRPL17; MRPL16; MRPL39; MRPL2; MRPL15; MRPL42; MRPS28; SCFD1; MRPL3; CUL7; MRPL19; MRPL23; SLC25A3; OGDH; NDUFS1; NDUFB10; MPV17; ICT1; HNRNPU; DLD; UBC; OX
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-MRPL13 (ARP54978_P050) antibody
Blocking Peptide For anti-MRPL13 (ARP54978_P050) antibody is Catalog # AAP54978 (Previous Catalog # AAPP32139)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MRPL13
Uniprot ID Q9BYD1
Protein Name 39S ribosomal protein L13, mitochondrial
Sample Type Confirmation

MRPL13 is supported by BioGPS gene expression data to be expressed in 721_B

Protein Accession # NP_054797
Purification Affinity Purified
Nucleotide Accession # NM_014078
Tested Species Reactivity Human
Gene Symbol MRPL13
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%
Image 1
Human 721_B
WB Suggested Anti-MRPL13 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysateMRPL13 is supported by BioGPS gene expression data to be expressed in 721_B
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com