| Product Number |
ARP54743_P050 |
| Product Page |
www.avivasysbio.com/ica1-antibody-c-terminal-region-arp54743-p050.html |
| Name |
ICA1 Antibody - C-terminal region (ARP54743_P050) |
| Protein Size (# AA) |
483 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
3382 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Islet cell autoantigen 1, 69kDa |
| Alias Symbols |
ICA69, ICAp69 |
| Peptide Sequence |
Synthetic peptide located within the following region: NMKDLQASLQEPAKAASDLTAWFSLFADLDPLSNPDAVGKTDKEHELLNA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
| Description of Target |
ICA1 is a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
| Protein Interactions |
RAB2B; ING5; MBD3; CCDC28A; RAB2A; tbc-8; EXOC5; STK16; MKKS; KRT33B; CNTF; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ICA1 (ARP54743_P050) antibody |
| Blocking Peptide |
For anti-ICA1 (ARP54743_P050) antibody is Catalog # AAP54743 (Previous Catalog # AAPP31538) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human ICA1 |
| Uniprot ID |
Q05084 |
| Protein Name |
Islet cell autoantigen 1 |
| Protein Accession # |
NP_071682 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_022307 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ICA1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-ICA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle |
|
|
