| Product Number |
ARP54697_P050 |
| Product Page |
www.avivasysbio.com/lyn-antibody-n-terminal-region-arp54697-p050.html |
| Name |
Lyn Antibody - N-terminal region (ARP54697_P050) |
| Protein Size (# AA) |
491 amino acids |
| Molecular Weight |
54kDa |
| NCBI Gene Id |
17096 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Yamaguchi sarcoma viral (v-yes-1) oncogene homolog |
| Alias Symbols |
Hck-2, p53Lyn, p56Lyn, AA407514 |
| Peptide Sequence |
Synthetic peptide located within the following region: QGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLSSKREGFI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Protein Interactions |
Dok1; Sh2d1b2; Cbl; Ubc; Khdrbs1; Crebbp; Hdac3; Ms4a2; Pag1; Hcls1; Ctla4; Epor; Evl; Jak2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Lyn (ARP54697_P050) antibody |
| Blocking Peptide |
For anti-Lyn (ARP54697_P050) antibody is Catalog # AAP54697 (Previous Catalog # AAPP31488) |
| Uniprot ID |
Q8CEI0 |
| Protein Name |
Putative uncharacterized protein EMBL BAC25753.1 |
| Protein Accession # |
NP_034877 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_010747 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Lyn |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 83% |
| Image 1 | Mouse Heart
 | WB Suggested Anti-Lyn Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Heart |
|
|
