Product Number |
ARP54685_P050 |
Product Page |
www.avivasysbio.com/lcn1-antibody-middle-region-arp54685-p050.html |
Name |
LCN1 Antibody - middle region (ARP54685_P050) |
Protein Size (# AA) |
176 amino acids |
Molecular Weight |
17kDa |
NCBI Gene Id |
3933 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lipocalin 1 |
Alias Symbols |
TP, TLC, PMFA, VEGP |
Peptide Sequence |
Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Yusifov,T.N., (er) Mol. Vis. 14, 180-188 (2008) |
Description of Target |
LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
WWOX; UBC; Cdca5; LMBR1L; LYZ; LTF; KHK; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LCN1 (ARP54685_P050) antibody |
Blocking Peptide |
For anti-LCN1 (ARP54685_P050) antibody is Catalog # AAP54685 (Previous Catalog # AAPP36804) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LCN1 |
Uniprot ID |
P31025 |
Protein Name |
Lipocalin-1 |
Protein Accession # |
NP_002288 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_002297 |
Tested Species Reactivity |
Human |
Gene Symbol |
LCN1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Pig |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Human: 100%; Mouse: 79%; Pig: 79%; Rat: 82% |
Image 1 | Human HepG2
| WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: HepG2 cell lysate |
| Image 2 | Human 293T Whole Cell
| Host: Rabbit Target Name: LCN1 Sample Tissue: Human 293T Whole Cell Antibody Dilution: 1ug/ml |
|
|