LCN1 Antibody - middle region (ARP54685_P050)

Data Sheet
 
Product Number ARP54685_P050
Product Page www.avivasysbio.com/lcn1-antibody-middle-region-arp54685-p050.html
Name LCN1 Antibody - middle region (ARP54685_P050)
Protein Size (# AA) 176 amino acids
Molecular Weight 17kDa
NCBI Gene Id 3933
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lipocalin 1
Alias Symbols TP, TLC, PMFA, VEGP
Peptide Sequence Synthetic peptide located within the following region: IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Yusifov,T.N., (er) Mol. Vis. 14, 180-188 (2008)
Description of Target LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.The protein encoded by this gene belongs to the lipocalin family. Lipocalins are a group of extracellular proteins that are able to bind lipophiles by enclosure within their structures to minimize solvent contact. This protein may bind hydrophobic ligands and inhibit cysteine proteinases. It may also play a role in taste reception. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions WWOX; UBC; Cdca5; LMBR1L; LYZ; LTF; KHK;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LCN1 (ARP54685_P050) antibody
Blocking Peptide For anti-LCN1 (ARP54685_P050) antibody is Catalog # AAP54685 (Previous Catalog # AAPP36804)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human LCN1
Uniprot ID P31025
Protein Name Lipocalin-1
Protein Accession # NP_002288
Purification Affinity Purified
Nucleotide Accession # NM_002297
Tested Species Reactivity Human
Gene Symbol LCN1
Predicted Species Reactivity Human, Mouse, Rat, Pig
Application WB
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 79%; Pig: 79%; Rat: 82%
Image 1
Human HepG2
WB Suggested Anti-LCN1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Image 2
Human 293T Whole Cell
Host: Rabbit
Target Name: LCN1
Sample Tissue: Human 293T Whole Cell
Antibody Dilution: 1ug/ml
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com