GNAQ Antibody - N-terminal region (ARP54635_P050)

Data Sheet
 
Product Number ARP54635_P050
Product Page www.avivasysbio.com/gnaq-antibody-n-terminal-region-arp54635-p050.html
Name GNAQ Antibody - N-terminal region (ARP54635_P050)
Protein Size (# AA) 359 amino acids
Molecular Weight 42kDa
Subunit alpha
NCBI Gene Id 2776
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Guanine nucleotide binding protein (G protein), q polypeptide
Alias Symbols GAQ, SWS, CMC1, G-ALPHA-q
Peptide Sequence Synthetic peptide located within the following region: DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Zapf,J., (2008) Am. J. Hum. Genet. 82 (6), 1270-1280
Description of Target Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G p
Protein Interactions AIP; UBC; GNB3; TBXA2R; IQSEC1; CYTH1; CYTH3; PSD; PLCB2; PLCB1; CYTH2; PTGIR; ARF6; WDR36; RIC8A; ADRBK1; ATP4A; NT5C3A; PPT1; LUM; Agtr1a; ADHFE1; CDK19; GNAS; MRGPRX1; F2R; Ric8b; TTC1; CRHR1; RGS18; RGS13; S1PR2; SLC9A3R1; AKAP13; GRM7; GRM4; GRM2; FF
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-GNAQ (ARP54635_P050) antibody
Blocking Peptide For anti-GNAQ (ARP54635_P050) antibody is Catalog # AAP54635 (Previous Catalog # AAPP31426)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human GNAQ
Uniprot ID P50148
Protein Name Guanine nucleotide-binding protein G(q) subunit alpha
Protein Accession # NP_002063
Purification Affinity Purified
Nucleotide Accession # NM_002072
Tested Species Reactivity Human
Gene Symbol GNAQ
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 100%
Image 1
Human Brain
WB Suggested Anti-GNAQ Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human brain
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com