| Product Number |
ARP54634_P050 |
| Product Page |
www.avivasysbio.com/gnal-antibody-c-terminal-region-arp54634-p050.html |
| Name |
GNAL Antibody - C-terminal region (ARP54634_P050) |
| Protein Size (# AA) |
458 amino acids |
| Molecular Weight |
50kDa |
| Subunit |
alpha |
| NCBI Gene Id |
2774 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type |
| Alias Symbols |
DYT25 |
| Peptide Sequence |
Synthetic peptide located within the following region: AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Laurin,N., (2008) J Psychiatr Res 42 (2), 117-124 |
| Description of Target |
Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters. |
| Protein Interactions |
UBC; SUMO1; Haus1; BABAM1; USP3; SPATA2; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-GNAL (ARP54634_P050) antibody |
| Blocking Peptide |
For anti-GNAL (ARP54634_P050) antibody is Catalog # AAP54634 (Previous Catalog # AAPP31425) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human GNAL |
| Uniprot ID |
P38405 |
| Protein Name |
Guanine nucleotide-binding protein G(olf) subunit alpha |
| Sample Type Confirmation |
GNAL is supported by BioGPS gene expression data to be expressed in HeLa |
| Protein Accession # |
NP_892023 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_182978 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
GNAL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human HeLa
 | WB Suggested Anti-GNAL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysateGNAL is supported by BioGPS gene expression data to be expressed in HeLa |
|
