| Product Number |
ARP54527_P050 |
| Product Page |
www.avivasysbio.com/klkbl4-antibody-c-terminal-region-arp54527-p050.html |
| Name |
Klkbl4 Antibody - C-terminal region (ARP54527_P050) |
| Protein Size (# AA) |
395 amino acids |
| Molecular Weight |
44kDa |
| NCBI Gene Id |
221191 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Protease, serine, 54 |
| Alias Symbols |
CT67, KLKBL4 |
| Peptide Sequence |
Synthetic peptide located within the following region: EASVQPLYYDYYGGEVGEGRIFAGQNRLYQPEEIILVSFVLVFFCSSI |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 |
| Description of Target |
Klkbl4 is a secreted protein. Klkbl4 belongs to the peptidase S1 family, plasma kallikrein subfamily. It contains 1 peptidase S1 domain. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-PRSS54 (ARP54527_P050) antibody |
| Blocking Peptide |
For anti-PRSS54 (ARP54527_P050) antibody is Catalog # AAP54527 (Previous Catalog # AAPP31311) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human Klkbl4 |
| Uniprot ID |
Q6PEW0 |
| Protein Name |
Inactive serine protease 54 |
| Protein Accession # |
NP_001073961 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001080492 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
PRSS54 |
| Predicted Species Reactivity |
Human, Horse |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Horse: 90%; Human: 100% |
| Image 1 | Human Muscle
 | WB Suggested Anti-Klkbl4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Muscle |
|
|
