| Product Number |
ARP54485_P050 |
| Product Page |
www.avivasysbio.com/meioc-antibody-c-terminal-region-arp54485-p050.html |
| Name |
MEIOC Antibody - C-terminal region (ARP54485_P050) |
| Protein Size (# AA) |
622 amino acids |
| Molecular Weight |
71kDa |
| NCBI Gene Id |
284071 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
meiosis specific with coiled-coil domain |
| Alias Symbols |
C17orf104 |
| Peptide Sequence |
Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MEIOC (ARP54485_P050) antibody |
| Blocking Peptide |
For anti-MEIOC (ARP54485_P050) antibody is Catalog # AAP54485 (Previous Catalog # AAPP31265) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848 |
| Uniprot ID |
A2RUB1 |
| Protein Name |
meiosis-specific coiled-coil domain-containing protein MEIOC |
| Protein Accession # |
NP_001028831 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001033659 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MEIOC |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human HT1080
 | WB Suggested Anti-FLJ35848 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HT1080 cell lysate |
|
|
