AMD1 Antibody - N-terminal region (ARP54480_P050)

Data Sheet
 
Product Number ARP54480_P050
Product Page www.avivasysbio.com/amd1-antibody-n-terminal-region-arp54480-p050.html
Name AMD1 Antibody - N-terminal region (ARP54480_P050)
Protein Size (# AA) 334 amino acids
Molecular Weight 38 kDa
NCBI Gene Id 262
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Adenosylmethionine decarboxylase 1
Alias Symbols AMD, SAMDC, ADOMETDC
Peptide Sequence Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Guidotti,A., (2007) Neuroreport 18 (1), 57-60
Description of Target The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified.
Protein Interactions ELAVL1; UBC; AMD1;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AMD1 (ARP54480_P050) antibody
Blocking Peptide For anti-AMD1 (ARP54480_P050) antibody is Catalog # AAP54480 (Previous Catalog # AAPP31260)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1
Uniprot ID Q5VXN4
Protein Name S-adenosylmethionine decarboxylase proenzyme
Protein Accession # NP_001028231
Purification Affinity Purified
Nucleotide Accession # NM_001033059
Tested Species Reactivity Human
Gene Symbol AMD1
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
AMD1 Antibody - N-terminal region (ARP54480_P050)
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com