Product Number |
ARP54480_P050 |
Product Page |
www.avivasysbio.com/amd1-antibody-n-terminal-region-arp54480-p050.html |
Name |
AMD1 Antibody - N-terminal region (ARP54480_P050) |
Protein Size (# AA) |
334 amino acids |
Molecular Weight |
38 kDa |
NCBI Gene Id |
262 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Adenosylmethionine decarboxylase 1 |
Alias Symbols |
AMD, SAMDC, ADOMETDC |
Peptide Sequence |
Synthetic peptide located within the following region: MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Guidotti,A., (2007) Neuroreport 18 (1), 57-60 |
Description of Target |
The specific function of AMD1 is not yet known.This gene encodes an important intermediate enzyme in polyamine biosynthesis. The polyamines spermine, spermidine, and putrescine are low-molecular-weight aliphatic amines essential for cellular proliferation and tumor promotion. Two alternatively spliced transcript variants that encode different proteins have been identified. |
Protein Interactions |
ELAVL1; UBC; AMD1; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AMD1 (ARP54480_P050) antibody |
Blocking Peptide |
For anti-AMD1 (ARP54480_P050) antibody is Catalog # AAP54480 (Previous Catalog # AAPP31260) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human AMD1 |
Uniprot ID |
Q5VXN4 |
Protein Name |
S-adenosylmethionine decarboxylase proenzyme |
Protein Accession # |
NP_001028231 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_001033059 |
Tested Species Reactivity |
Human |
Gene Symbol |
AMD1 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
Image 1 | AMD1 Antibody - N-terminal region (ARP54480_P050)
| 25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
|
|
|