| Product Number |
ARP54453_P050 |
| Product Page |
www.avivasysbio.com/sh3kbp1-antibody-n-terminal-region-arp54453-p050.html |
| Name |
SH3KBP1 Antibody - N-terminal region (ARP54453_P050) |
| Protein Size (# AA) |
628 amino acids |
| Molecular Weight |
68 |
| NCBI Gene Id |
30011 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SH3-domain kinase binding protein 1 |
| Alias Symbols |
HSB1, AGMX2, CIN85, GIG10, HSB-1, IMD61, MIG18, CD2BP3 |
| Peptide Sequence |
Synthetic peptide located within the following region: TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene encodes an adapter protein that contains three N-terminal Src homology domains, a proline rich region and a C-terminal coiled-coil domain. The encoded protein facilitates protein-protein interactions and has been implicated in numerous cellular processes including apoptosis, cytoskeletal rearrangement, cell adhesion and in the regulation of clathrin-dependent endocytosis. Alternate splicing results in multiple transcript variants. |
| Protein Interactions |
PNMA5; ZBTB7B; SH3KBP1; STAP1; FRS3; SPRY2; ASAP2; PSMA3; CBL; UBC; RAF1; LOX; INPP5D; Dlg4; FAP; ARHGAP17; Ap2a1; Irf2bp1; Gcdh; Sept7; Wipf1; Chtf8; Cblb; Shkbp1; Rtkn2; Idh3b; Pik3ap1; Slc25a12; Wasl; Ap2b1; Arap1; Far1; Cltc; Timm50; Actn4; Sept6; Net |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SH3KBP1 (ARP54453_P050) antibody |
| Blocking Peptide |
For anti-SH3KBP1 (ARP54453_P050) antibody is Catalog # AAP54453 (Previous Catalog # AAPP43233) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SH3KBP1 |
| Uniprot ID |
Q5JPT5 |
| Protein Name |
SH3 domain-containing kinase-binding protein 1 |
| Protein Accession # |
NP_001019837 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001024666 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SH3KBP1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB, IHC |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85% |
| Image 1 | Human Jurkat
 | WB Suggested Anti-SH3KBP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate |
|
| Image 2 | Human heart
 | Rabbit Anti-SH3KBP1 Antibody
Catalog Number: ARP54453_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic, plasma membrane
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec |
|
