| Product Number |
ARP54357_P050 |
| Product Page |
www.avivasysbio.com/guk1-antibody-n-terminal-region-arp54357-p050.html |
| Name |
Guk1 Antibody - N-terminal region (ARP54357_P050) |
| Protein Size (# AA) |
219 amino acids |
| Molecular Weight |
24kDa |
| NCBI Gene Id |
303179 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Guanylate kinase 1 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: RPVVLSGPSGAGKSTLLKKLFQEHGSVFGFSVSHTTRNPRPGEEDGKDYY |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of this protein remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Guk1 (ARP54357_P050) antibody |
| Blocking Peptide |
For anti-Guk1 (ARP54357_P050) antibody is Catalog # AAP54357 (Previous Catalog # AAPP31132) |
| Uniprot ID |
E9PTV0 |
| Protein Name |
Protein Guk1 Ensembl ENSRNOP00000003926 |
| Protein Accession # |
NP_001013133 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001013115 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Guk1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Yeast: 93%; Zebrafish: 100% |
| Image 1 | Rat Muscle
 | WB Suggested Anti-Guk1 Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Muscle |
|
|
