REXO5 Antibody - middle region (ARP53797_P050)

• Product Number: ARP53797_P050
• Name: REXO5 Antibody - middle region (ARP53797_P050)
• Protein Size (# AA): 774 amino acids
• Molecular Weight: 85kDa
• NCBI Gene Id: 81691
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: RNA exonuclease 5
• Alias Symbols: NEF-sp
• Peptide Sequence: Synthetic peptide located within the following region: AEGGCCVMDELVKPENKILDYLTSFSGITKKILNPVTTKLKDVQRQLKAL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Mehrle,A., Nucleic Acids Res. 34 (DATABASE ISSUE), D415-D418 (2006)
• Protein Interactions: IGBP1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-REXO5 (ARP53797_P050) antibody is Catalog # AAP53797 (Previous Catalog # AAPP30639)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LOC81691
• Uniprot ID: Q96IC2
• Protein Name: RNA exonuclease 5
• Sample Type Confirmation:

  LOC81691 is strongly supported by BioGPS gene expression data to be expressed in MCF7

• Protein Accession #: NP_112203
• Purification: Affinity Purified
• Nucleotide Accession #: NM_030941
• Tested Species Reactivity: Human
• Gene Symbol: REXO5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Guinea Pig: 75%; Horse: 86%; Human: 100%; Mouse: 85%; Rabbit: 86%; Rat: 86%
• Image 1: Human MCF7
  
  WB Suggested Anti-LOC81691 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:1562500
  Positive Control: MCF7 cell lysateLOC81691 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells