| Product Number |
ARP53710_P050 |
| Product Page |
www.avivasysbio.com/sccpdh-antibody-middle-region-arp53710-p050.html |
| Name |
SCCPDH Antibody - middle region (ARP53710_P050) |
| Protein Size (# AA) |
429 amino acids |
| Molecular Weight |
47kDa |
| NCBI Gene Id |
51097 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Saccharopine dehydrogenase (putative) |
| Alias Symbols |
NET11, CGI-49 |
| Peptide Sequence |
Synthetic peptide located within the following region: SDVSVVRRTQRYLYENLEESPVQYAAYVTVGGITSVIKLMFAGLFFLFFV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
SCCPDH belongs to the saccharopine dehydrogenase family. The exact function of SCCPDH remains unknown. |
| Protein Interactions |
UBC; PAXIP1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SCCPDH (ARP53710_P050) antibody |
| Blocking Peptide |
For anti-SCCPDH (ARP53710_P050) antibody is Catalog # AAP53710 (Previous Catalog # AAPP45607) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SCCPDH |
| Uniprot ID |
Q5R5C9 |
| Protein Name |
Saccharopine dehydrogenase-like oxidoreductase |
| Protein Accession # |
NP_057086 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_016002 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SCCPDH |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 86%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86% |
| Image 1 | Human Liver
 | WB Suggested Anti-SCCPDH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Liver |
|
|
