LIX1L Antibody - N-terminal region (ARP53201_P050)

Data Sheet
 
Product Number ARP53201_P050
Product Page www.avivasysbio.com/lix1l-antibody-n-terminal-region-arp53201-p050.html
Name LIX1L Antibody - N-terminal region (ARP53201_P050)
Protein Size (# AA) 337 amino acids
Molecular Weight 36kDa
NCBI Gene Id 128077
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Lix1 homolog (mouse)-like
Alias Symbols DKFZp762F237, MGC46719
Peptide Sequence Synthetic peptide located within the following region: AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)
Description of Target The exact functions of LIX1L remain unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-LIX1L (ARP53201_P050) antibody
Blocking Peptide For anti-LIX1L (ARP53201_P050) antibody is Catalog # AAP53201 (Previous Catalog # AAPP36338)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human LIX1L
Uniprot ID Q8IVB5
Protein Name LIX1-like protein
Protein Accession # NP_714924
Purification Affinity Purified
Nucleotide Accession # NM_153713
Tested Species Reactivity Human
Gene Symbol LIX1L
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Image 1
Human Lung
WB Suggested Anti-LIX1L Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com