Product Number |
ARP53201_P050 |
Product Page |
www.avivasysbio.com/lix1l-antibody-n-terminal-region-arp53201-p050.html |
Name |
LIX1L Antibody - N-terminal region (ARP53201_P050) |
Protein Size (# AA) |
337 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
128077 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Lix1 homolog (mouse)-like |
Alias Symbols |
DKFZp762F237, MGC46719 |
Peptide Sequence |
Synthetic peptide located within the following region: AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKN |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004) |
Description of Target |
The exact functions of LIX1L remain unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-LIX1L (ARP53201_P050) antibody |
Blocking Peptide |
For anti-LIX1L (ARP53201_P050) antibody is Catalog # AAP53201 (Previous Catalog # AAPP36338) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human LIX1L |
Uniprot ID |
Q8IVB5 |
Protein Name |
LIX1-like protein |
Protein Accession # |
NP_714924 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_153713 |
Tested Species Reactivity |
Human |
Gene Symbol |
LIX1L |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Human Lung
| WB Suggested Anti-LIX1L Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Human Lung |
|
|