| Product Number |
ARP53181_P050 |
| Product Page |
www.avivasysbio.com/ldhd-antibody-middle-region-arp53181-p050.html |
| Name |
LDHD Antibody - middle region (ARP53181_P050) |
| Protein Size (# AA) |
507 amino acids |
| Molecular Weight |
53kDa |
| NCBI Gene Id |
197257 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lactate dehydrogenase D |
| Alias Symbols |
DLD, DLACD |
| Peptide Sequence |
Synthetic peptide located within the following region: LLVNPDDAEELGRVKAFAEQLGRRALALHGTCTGEHGIGMGKRQLLQEEV |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Flick,M.J. (2002) Biochem. Biophys. Res. Commun. 295 (4), 910-916 |
| Description of Target |
The exact functions of LDHD remain unknown.The protein encoded by this gene belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family. The similar protein in yeast has both D-lactate and D-glycerate dehydrogenase activities. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. |
| Protein Interactions |
CAND1; CUL3; CUL5; CSRP3; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LDHD (ARP53181_P050) antibody |
| Blocking Peptide |
For anti-LDHD (ARP53181_P050) antibody is Catalog # AAP53181 (Previous Catalog # AAPP36319) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LDHD |
| Uniprot ID |
Q86WU2 |
| Protein Name |
Probable D-lactate dehydrogenase, mitochondrial |
| Protein Accession # |
NP_705690 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153486 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LDHD |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 93%; Rat: 93% |
| Image 1 | Human Heart
 | WB Suggested Anti-LDHD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart |
|
|
