TMEM161B Antibody - N-terminal region (ARP53169_P050)

Data Sheet
 
Product Number ARP53169_P050
Product Page www.avivasysbio.com/tmem161b-antibody-n-terminal-region-arp53169-p050.html
Name TMEM161B Antibody - N-terminal region (ARP53169_P050)
Protein Size (# AA) 487 amino acids
Molecular Weight 55kDa
NCBI Gene Id 153396
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Transmembrane protein 161B
Alias Symbols FLB3342, PRO1313
Peptide Sequence Synthetic peptide located within the following region: ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Description of Target The exact functions of TMEM161B remain unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TMEM161B (ARP53169_P050) antibody
Blocking Peptide For anti-TMEM161B (ARP53169_P050) antibody is Catalog # AAP53169 (Previous Catalog # AAPP36239)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM161B
Uniprot ID Q8NDZ6
Protein Name Transmembrane protein 161B
Protein Accession # NP_699185
Purification Affinity Purified
Nucleotide Accession # NM_153354
Tested Species Reactivity Human
Gene Symbol TMEM161B
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human Jurkat
WB Suggested Anti-TMEM161B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Jurkat cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com