Product Number |
ARP53169_P050 |
Product Page |
www.avivasysbio.com/tmem161b-antibody-n-terminal-region-arp53169-p050.html |
Name |
TMEM161B Antibody - N-terminal region (ARP53169_P050) |
Protein Size (# AA) |
487 amino acids |
Molecular Weight |
55kDa |
NCBI Gene Id |
153396 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Transmembrane protein 161B |
Alias Symbols |
FLB3342, PRO1313 |
Peptide Sequence |
Synthetic peptide located within the following region: ESKPLTIPKDIDLHLETKSVTEVDTLALHYFPEYQWLVDFTVAATVVYLV |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270 |
Description of Target |
The exact functions of TMEM161B remain unknown. |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-TMEM161B (ARP53169_P050) antibody |
Blocking Peptide |
For anti-TMEM161B (ARP53169_P050) antibody is Catalog # AAP53169 (Previous Catalog # AAPP36239) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM161B |
Uniprot ID |
Q8NDZ6 |
Protein Name |
Transmembrane protein 161B |
Protein Accession # |
NP_699185 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_153354 |
Tested Species Reactivity |
Human |
Gene Symbol |
TMEM161B |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
Image 1 | Human Jurkat
| WB Suggested Anti-TMEM161B Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: Jurkat cell lysate |
|
|