| Product Number |
ARP53165_P050 |
| Product Page |
www.avivasysbio.com/fbxl16-antibody-middle-region-arp53165-p050.html |
| Name |
FBXL16 Antibody - middle region (ARP53165_P050) |
| Protein Size (# AA) |
479 amino acids |
| Molecular Weight |
52kDa |
| NCBI Gene Id |
146330 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
F-box and leucine-rich repeat protein 16 |
| Alias Symbols |
Fbl16, C16orf22, c380A1.1 |
| Peptide Sequence |
Synthetic peptide located within the following region: GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Martin,J., (2004) Nature 432 (7020), 988-994 |
| Description of Target |
FBXL16 is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXL16, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]. |
| Protein Interactions |
HPCAL4; LATS2; MAPK6; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FBXL16 (ARP53165_P050) antibody |
| Blocking Peptide |
For anti-FBXL16 (ARP53165_P050) antibody is Catalog # AAP53165 (Previous Catalog # AAPP36235) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human FBXL16 |
| Uniprot ID |
Q8N461 |
| Protein Name |
F-box/LRR-repeat protein 16 |
| Protein Accession # |
NP_699181 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153350 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FBXL16 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 86% |
| Image 1 | Human HeLa
 | WB Suggested Anti-FBXL16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate |
|
