Eid2 Antibody - C-terminal region (ARP53146_P050)

• Product Number: ARP53146_P050
• Name: Eid2 Antibody - C-terminal region (ARP53146_P050)
• Protein Size (# AA): 236 amino acids
• Molecular Weight: 26kDa
• NCBI Gene Id: 386655
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: EP300 interacting inhibitor of differentiation 2
• Alias Symbols: Cr, Cri2, EID-, EID-2
• Peptide Sequence: Synthetic peptide located within the following region: QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRVD
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: Eid2 interacts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. It inhibits EP300 ihistone acetyltransferase activity. It acts as a repressor of TGFB/SMAD transcriptional responses. It may act as a repressor of the TGFB/SMAD3-dependent signaling by selectively blocking formation of TGFB-induced SMAD3-SMAD4 complex.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-Eid2 (ARP53146_P050) antibody is Catalog # AAP53146
• Uniprot ID: Q6X7S9
• Protein Name: EP300-interacting inhibitor of differentiation 2
• Protein Accession #: NP_940817
• Purification: Affinity Purified
• Nucleotide Accession #: NM_198425
• Tested Species Reactivity: Mouse
• Gene Symbol: Eid2
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 93%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Image 1: Mouse Kidney
  
  WB Suggested Anti-Eid2 Antibody
  Titration: 1.0 ug/ml
  Positive Control: Mouse Kidney