| Product Number |
ARP53139_P050 |
| Product Page |
www.avivasysbio.com/c13orf31-antibody-middle-region-arp53139-p050.html |
| Name |
C13orf31 Antibody - middle region (ARP53139_P050) |
| Protein Size (# AA) |
430 amino acids |
| Molecular Weight |
48kDa |
| NCBI Gene Id |
144811 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Laccase (multicopper oxidoreductase) domain containing 1 |
| Alias Symbols |
FAMIN, JUVAR, C13orf31 |
| Peptide Sequence |
Synthetic peptide located within the following region: TIITSSLIPDIFIHGFTTRTGGISYIPTLSSFNLFSSSKRRDPKVVVQEN |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Kimura,K., (2006) Genome Res. 16 (1), 55-65 |
| Description of Target |
The exact functions of C13orf31 remain unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-LACC1 (ARP53139_P050) antibody |
| Blocking Peptide |
For anti-LACC1 (ARP53139_P050) antibody is Catalog # AAP53139 (Previous Catalog # AAPP36208) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human C13orf31 |
| Uniprot ID |
Q8IV20 |
| Protein Name |
Laccase domain-containing protein 1 |
| Protein Accession # |
NP_694950 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_153218 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LACC1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Lung
 | WB Suggested Anti-C13orf31 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Lung |
|
|
