CCDC128 Antibody - N-terminal region (ARP53125_P050)

Data Sheet
 
Product Number ARP53125_P050
Product Page www.avivasysbio.com/ccdc128-antibody-n-terminal-region-arp53125-p050.html
Name CCDC128 Antibody - N-terminal region (ARP53125_P050)
Protein Size (# AA) 769 amino acids
Molecular Weight 87kDa
NCBI Gene Id 129285
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Protein phosphatase 1, regulatory subunit 21
Alias Symbols KLRAQ1, CCDC128
Peptide Sequence Synthetic peptide located within the following region: KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Ota,T., (2004) Nat. Genet. 36 (1), 40-45
Description of Target The exact functions of CCDC128 remain unknown.
Protein Interactions PPP1CA; TXNDC5; CUL2; SH3GL2;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPP1R21 (ARP53125_P050) antibody
Blocking Peptide For anti-PPP1R21 (ARP53125_P050) antibody is Catalog # AAP53125 (Previous Catalog # AAPP35607)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC128
Uniprot ID Q6ZMI0
Protein Name Protein phosphatase 1 regulatory subunit 21
Protein Accession # NP_694539
Purification Affinity Purified
Nucleotide Accession # NM_152994
Tested Species Reactivity Human
Gene Symbol PPP1R21
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Image 1
Human Muscle
WB Suggested Anti-CCDC128 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com