Product Number |
ARP53125_P050 |
Product Page |
www.avivasysbio.com/ccdc128-antibody-n-terminal-region-arp53125-p050.html |
Name |
CCDC128 Antibody - N-terminal region (ARP53125_P050) |
Protein Size (# AA) |
769 amino acids |
Molecular Weight |
87kDa |
NCBI Gene Id |
129285 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Protein phosphatase 1, regulatory subunit 21 |
Alias Symbols |
KLRAQ1, CCDC128 |
Peptide Sequence |
Synthetic peptide located within the following region: KRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Ota,T., (2004) Nat. Genet. 36 (1), 40-45 |
Description of Target |
The exact functions of CCDC128 remain unknown. |
Protein Interactions |
PPP1CA; TXNDC5; CUL2; SH3GL2; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-PPP1R21 (ARP53125_P050) antibody |
Blocking Peptide |
For anti-PPP1R21 (ARP53125_P050) antibody is Catalog # AAP53125 (Previous Catalog # AAPP35607) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC128 |
Uniprot ID |
Q6ZMI0 |
Protein Name |
Protein phosphatase 1 regulatory subunit 21 |
Protein Accession # |
NP_694539 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152994 |
Tested Species Reactivity |
Human |
Gene Symbol |
PPP1R21 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79% |
Image 1 | Human Muscle
| WB Suggested Anti-CCDC128 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:12500 Positive Control: Human Muscle |
|
|