HIBADH Antibody - middle region (ARP53112_P050)

Data Sheet
 
Product Number ARP53112_P050
Product Page www.avivasysbio.com/hibadh-antibody-middle-region-arp53112-p050.html
Name HIBADH Antibody - middle region (ARP53112_P050)
Protein Size (# AA) 336 amino acids
Molecular Weight 35kDa
NCBI Gene Id 11112
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name 3-hydroxyisobutyrate dehydrogenase
Alias Symbols NS5ATP1
Peptide Sequence Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222
Description of Target 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397
Protein Interactions BRCA1; ELAVL1; UBC; TRIM63; HIBADH;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-HIBADH (ARP53112_P050) antibody
Blocking Peptide For anti-HIBADH (ARP53112_P050) antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human HIBADH
Uniprot ID P31937
Protein Name 3-hydroxyisobutyrate dehydrogenase, mitochondrial
Protein Accession # NP_689953
Purification Affinity Purified
Nucleotide Accession # NM_152740
Tested Species Reactivity Human
Gene Symbol HIBADH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Image 1
Human Liver
WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com