Product Number |
ARP53112_P050 |
Product Page |
www.avivasysbio.com/hibadh-antibody-middle-region-arp53112-p050.html |
Name |
HIBADH Antibody - middle region (ARP53112_P050) |
Protein Size (# AA) |
336 amino acids |
Molecular Weight |
35kDa |
NCBI Gene Id |
11112 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
3-hydroxyisobutyrate dehydrogenase |
Alias Symbols |
NS5ATP1 |
Peptide Sequence |
Synthetic peptide located within the following region: WSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPIL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Hughes,G.J., (1993) Electrophoresis 14 (11), 1216-1222 |
Description of Target |
3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-557 BQ051350.1 1-557 558-1832 BC020167.1 437-1711 1833-1970 BC013855.1 1224-1361 1971-1994 BC020167.1 1850-1873 1995-2006 BC013855.1 1386-1397 |
Protein Interactions |
BRCA1; ELAVL1; UBC; TRIM63; HIBADH; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-HIBADH (ARP53112_P050) antibody |
Blocking Peptide |
For anti-HIBADH (ARP53112_P050) antibody is Catalog # AAP53112 (Previous Catalog # AAPP34421) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human HIBADH |
Uniprot ID |
P31937 |
Protein Name |
3-hydroxyisobutyrate dehydrogenase, mitochondrial |
Protein Accession # |
NP_689953 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_152740 |
Tested Species Reactivity |
Human |
Gene Symbol |
HIBADH |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86% |
Image 1 | Human Liver
| WB Suggested Anti-HIBADH Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Human Liver |
|