BBS5 Antibody - middle region (ARP52931_P050)

• Product Number: ARP52931_P050
• Name: BBS5 Antibody - middle region (ARP52931_P050)
• Protein Size (# AA): 341 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 129880
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Bardet-Biedl syndrome 5
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: VEIDSDGHTDAFVAYFADGNKQQDREPVFSEELGLAIEKLKDGFTLQGLW
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Hjortshoj,T.D., (2008) Am. J. Med. Genet. A 146A (4), 517-520
• Description of Target: BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.This gene encodes a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia. Alternate transcriptional splice variants have been observed but have not been fully characterized.
• Protein Interactions: KLC3; CRADD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BBS5 (ARP52931_P050) antibody is Catalog # AAP52931 (Previous Catalog # AAPP34917)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BBS5
• Uniprot ID: Q8N3I7
• Protein Name: Bardet-Biedl syndrome 5 protein
• Protein Accession #: NP_689597
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152384
• Tested Species Reactivity: Human
• Gene Symbol: BBS5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
• Image 1: Human 293T
  
  WB Suggested Anti-BBS5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: 293T cell lysate