BBS5 Antibody - N-terminal region (ARP52930_P050)

• Product Number: ARP52930_P050
• Name: BBS5 Antibody - N-terminal region (ARP52930_P050)
• Protein Size (# AA): 341 amino acids
• Molecular Weight: 39kDa
• NCBI Gene Id: 129880
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Bardet-Biedl syndrome 5
• Alias Symbols: -
• Peptide Sequence: Synthetic peptide located within the following region: MSVLDALWEDRDVRFDLSAQQMKTRPGEVLIDCLDSIEDTKGNNGDRGRL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: BBS5 is a protein that has been directly linked to Bardet-Biedl syndrome. The primary features of this syndrome include retinal dystrophy, obesity, polydactyly, renal abnormalities and learning disabilities. Experimentation in non-human eukaryotes suggests that this gene is expressed in ciliated cells and that it is required for the formation of cilia.
• Protein Interactions: KLC3; CRADD;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-BBS5 (ARP52930_P050) antibody is Catalog # AAP52930 (Previous Catalog # AAPP40903)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BBS5
• Uniprot ID: Q8N3I7
• Protein Name: Bardet-Biedl syndrome 5 protein
• Protein Accession #: NP_689597
• Purification: Affinity Purified
• Nucleotide Accession #: NM_152384
• Tested Species Reactivity: Human
• Gene Symbol: BBS5
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Image 1: Human COLO205
  
  WB Suggested Anti-BBS5 Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:312500
  Positive Control: COLO205 cell lysate