FBXO32 Antibody - N-terminal region (ARP52865_P050)

• Product Number: ARP52865_P050
• Name: FBXO32 Antibody - N-terminal region (ARP52865_P050)
• Protein Size (# AA): 355 amino acids
• Molecular Weight: 42 kDa
• NCBI Gene Id: 114907
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: F-box protein 32
• Alias Symbols: Fbx32, MAFbx
• Peptide Sequence: Synthetic peptide located within the following region: QQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRLSDGRDLVSLGQAAPDL
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Description of Target: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing of this gene results in two transcript variants encoding two isoforms of different sizes.
• Protein Interactions: UBC; MLH1; Mutyh; UBE2D3; KHDRBS3; SERPINB5; CDC34; DUSP1; FBXO25; MYBPC3; CDKN1A; EIF3F; SKP1; EIF3A;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Blocking Peptide: For anti-FBXO32 (ARP52865_P050) antibody is Catalog # AAP52865 (Previous Catalog # AAPP33923)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FBXO32
• Uniprot ID: Q0VAQ6
• Protein Name: F-box protein 32 EMBL AAI20965.1
• Protein Accession #: NP_680482
• Purification: Affinity Purified
• Nucleotide Accession #: NM_148177
• Tested Species Reactivity: Human
• Gene Symbol: FBXO32
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
• Image 1: 25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.
  
  25 ug of the indicated Human whole cell or tissue extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.