Product Number |
ARP52812_P050 |
Product Page |
www.avivasysbio.com/vti1a-antibody-n-terminal-region-arp52812-p050.html |
Name |
VTI1A Antibody - N-terminal region (ARP52812_P050) |
Protein Size (# AA) |
217 amino acids |
Molecular Weight |
25kDa |
NCBI Gene Id |
143187 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Vesicle transport through interaction with t-SNAREs homolog 1A (yeast) |
Alias Symbols |
MMDS3, MVti1, VTI1RP2, Vti1-rp2 |
Peptide Sequence |
Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Tai,G., (2004) Mol. Biol. Cell 15 (9), 4011-4022 |
Description of Target |
VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence. |
Protein Interactions |
UBC; env; TMBIM6; STX16; STX8; VAMP3; VAMP4; VAMP8; STX7; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-VTI1A (ARP52812_P050) antibody |
Blocking Peptide |
For anti-VTI1A (ARP52812_P050) antibody is Catalog # AAP52812 (Previous Catalog # AAPP33824) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human VTI1A |
Uniprot ID |
Q5W0D7 |
Protein Name |
Vesicle transport through interaction with t-SNAREs homolog 1A |
Protein Accession # |
NP_660207 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_145206 |
Tested Species Reactivity |
Human |
Gene Symbol |
VTI1A |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93% |
Image 1 | Human Muscle
| WB Suggested Anti-VTI1A Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Muscle |
|