VTI1A Antibody - N-terminal region (ARP52812_P050)

Data Sheet
 
Product Number ARP52812_P050
Product Page www.avivasysbio.com/vti1a-antibody-n-terminal-region-arp52812-p050.html
Name VTI1A Antibody - N-terminal region (ARP52812_P050)
Protein Size (# AA) 217 amino acids
Molecular Weight 25kDa
NCBI Gene Id 143187
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Vesicle transport through interaction with t-SNAREs homolog 1A (yeast)
Alias Symbols MMDS3, MVti1, VTI1RP2, Vti1-rp2
Peptide Sequence Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Tai,G., (2004) Mol. Biol. Cell 15 (9), 4011-4022
Description of Target VTI1A is a V-SNARE that mediates vesicle transport pathways through interactions with t-SNAREs on the target membrane. These interactions are proposed to mediate aspects of the specificity of vesicle trafficking and to promote fusion of the lipid bilayers. VTI1A may be concerned with increased secretion of cytokines associated with cellular senescence.
Protein Interactions UBC; env; TMBIM6; STX16; STX8; VAMP3; VAMP4; VAMP8; STX7;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-VTI1A (ARP52812_P050) antibody
Blocking Peptide For anti-VTI1A (ARP52812_P050) antibody is Catalog # AAP52812 (Previous Catalog # AAPP33824)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human VTI1A
Uniprot ID Q5W0D7
Protein Name Vesicle transport through interaction with t-SNAREs homolog 1A
Protein Accession # NP_660207
Purification Affinity Purified
Nucleotide Accession # NM_145206
Tested Species Reactivity Human
Gene Symbol VTI1A
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 93%
Image 1
Human Muscle
WB Suggested Anti-VTI1A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com