AIFM3 Antibody - middle region (ARP52745_P050)

Data Sheet
 
Product Number ARP52745_P050
Product Page www.avivasysbio.com/aifm3-antibody-middle-region-arp52745-p050.html
Name AIFM3 Antibody - middle region (ARP52745_P050)
Protein Size (# AA) 605 amino acids
Molecular Weight 67kDa
NCBI Gene Id 150209
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Apoptosis-inducing factor, mitochondrion-associated, 3
Alias Symbols AIFL
Peptide Sequence Synthetic peptide located within the following region: EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Urbano,A., (2005) EMBO J. 24 (15), 2815-2826
Description of Target AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.
Protein Interactions APP; PRNP;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-AIFM3 (ARP52745_P050) antibody
Blocking Peptide For anti-AIFM3 (ARP52745_P050) antibody is Catalog # AAP52745 (Previous Catalog # AAPP33627)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human AIFM3
Uniprot ID Q96NN9
Protein Name Apoptosis-inducing factor 3
Protein Accession # NP_653305
Purification Affinity Purified
Nucleotide Accession # NM_144704
Tested Species Reactivity Human
Gene Symbol AIFM3
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-AIFM3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com