Product Number |
ARP52745_P050 |
Product Page |
www.avivasysbio.com/aifm3-antibody-middle-region-arp52745-p050.html |
Name |
AIFM3 Antibody - middle region (ARP52745_P050) |
Protein Size (# AA) |
605 amino acids |
Molecular Weight |
67kDa |
NCBI Gene Id |
150209 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Apoptosis-inducing factor, mitochondrion-associated, 3 |
Alias Symbols |
AIFL |
Peptide Sequence |
Synthetic peptide located within the following region: EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Urbano,A., (2005) EMBO J. 24 (15), 2815-2826 |
Description of Target |
AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential. |
Protein Interactions |
APP; PRNP; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-AIFM3 (ARP52745_P050) antibody |
Blocking Peptide |
For anti-AIFM3 (ARP52745_P050) antibody is Catalog # AAP52745 (Previous Catalog # AAPP33627) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human AIFM3 |
Uniprot ID |
Q96NN9 |
Protein Name |
Apoptosis-inducing factor 3 |
Protein Accession # |
NP_653305 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_144704 |
Tested Species Reactivity |
Human |
Gene Symbol |
AIFM3 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Rabbit, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 93% |
Image 1 | Human HeLa
| WB Suggested Anti-AIFM3 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Hela cell lysate |
|
|