| Product Number |
ARP52668_P050 |
| Product Page |
www.avivasysbio.com/unq1887-antibody-middle-region-arp52668-p050.html |
| Name |
UNQ1887 Antibody - middle region (ARP52668_P050) |
| Protein Size (# AA) |
384 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
121665 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Signal peptide peptidase like 3 |
| Alias Symbols |
IMP2, PSH1, PSL4, PRO4332, MDHV1887 |
| Peptide Sequence |
Synthetic peptide located within the following region: VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
UNQ1887 may act as intramembrane protease. |
| Protein Interactions |
UBC; ELAVL1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SPPL3 (ARP52668_P050) antibody |
| Blocking Peptide |
For anti-SPPL3 (ARP52668_P050) antibody is Catalog # AAP52668 (Previous Catalog # AAPP42638) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human UNQ1887 |
| Uniprot ID |
Q3MJ04 |
| Protein Name |
Signal peptide peptidase-like 3 |
| Protein Accession # |
NP_620584 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_139015 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SPPL3 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Image 1 | Human A549
 | WB Suggested Anti-UNQ1887 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: A549 cell lysate |
|
|
