| Product Number |
ARP52432_P050 |
| Product Page |
www.avivasysbio.com/rwdd2a-antibody-n-terminal-region-arp52432-p050.html |
| Name |
RWDD2A Antibody - N-terminal region (ARP52432_P050) |
| Protein Size (# AA) |
292 amino acids |
| Molecular Weight |
32kDa |
| NCBI Gene Id |
112611 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
RWD domain containing 2A |
| Alias Symbols |
RWDD2, dJ747H23.2 |
| Peptide Sequence |
Synthetic peptide located within the following region: NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Mungall,A.J., (2003) Nature 425 (6960), 805-811 |
| Description of Target |
The specific function of RWDD2A is not yet known. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-RWDD2A (ARP52432_P050) antibody |
| Blocking Peptide |
For anti-RWDD2A (ARP52432_P050) antibody is Catalog # AAP52432 (Previous Catalog # AAPS31806) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human RWDD2A |
| Uniprot ID |
Q9UIY3 |
| Protein Name |
RWD domain-containing protein 2A |
| Protein Accession # |
NP_219479 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_033411 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
RWDD2A |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 86%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100% |
| Image 1 | Human Thymus
 | WB Suggested Anti-RWDD2A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Thymus |
|
|
