C1qtnf2 Antibody - middle region (ARP52422_P050)

Data Sheet
 
Product Number ARP52422_P050
Product Page www.avivasysbio.com/c1qtnf2-antibody-middle-region-arp52422-p050.html
Name C1qtnf2 Antibody - middle region (ARP52422_P050)
Protein Size (# AA) 294 amino acids
Molecular Weight 32kDa
NCBI Gene Id 69183
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name C1q and tumor necrosis factor related protein 2
Alias Symbols CTR, Adih, CTRP2, 1810033K05Rik
Peptide Sequence Synthetic peptide located within the following region: KKGPKGKKGEPGLPGPCSCGSSRAKSAFSVAVTKSYPRERLPIKFDKILM
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The function of this protein remains unknown.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-C1qtnf2 (ARP52422_P050) antibody
Blocking Peptide For anti-C1qtnf2 (ARP52422_P050) antibody is Catalog # AAP52422 (Previous Catalog # AAPS31709)
Uniprot ID Q9D8U4
Protein Name Complement C1q tumor necrosis factor-related protein 2
Protein Accession # NP_081255
Purification Affinity Purified
Nucleotide Accession # NM_026979
Tested Species Reactivity Mouse
Gene Symbol C1qtnf2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Image 1
Mouse Kidney
WB Suggested Anti-C1qtnf2 Antibody
Titration: 1.0 ug/ml
Positive Control: Mouse Kidney
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com