Product Number |
ARP52403_P050 |
Product Page |
www.avivasysbio.com/csh2-antibody-middle-region-arp52403-p050.html |
Name |
CSH2 Antibody - middle region (ARP52403_P050) |
Protein Size (# AA) |
122 amino acids |
Molecular Weight |
14 |
NCBI Gene Id |
1443 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Chorionic somatomammotropin hormone 2 |
Alias Symbols |
PL, CSB, CS-2, GHB1, hCS-B |
Peptide Sequence |
Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity. |
Protein Interactions |
PTPN12; SMAD9; SMAD4; SMAD3; SMAD2; POLR2A; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CSH2 (ARP52403_P050) antibody |
Blocking Peptide |
For anti-CSH2 (ARP52403_P050) antibody is Catalog # AAP52403 (Previous Catalog # AAPP14347) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CSH2 |
Uniprot ID |
B1A4H9 |
Protein Name |
Chorionic somatomammotropin hormone Ensembl ENSP00000308396 |
Protein Accession # |
NP_072171 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_022645 |
Tested Species Reactivity |
Human |
Gene Symbol |
CSH2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 86%; Goat: 90%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%; Sheep: 90% |
Image 1 | Human Placenta
| WB Suggested Anti-CSH2 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Placenta |
|