CSH2 Antibody - middle region (ARP52403_P050)

Data Sheet
 
Product Number ARP52403_P050
Product Page www.avivasysbio.com/csh2-antibody-middle-region-arp52403-p050.html
Name CSH2 Antibody - middle region (ARP52403_P050)
Protein Size (# AA) 122 amino acids
Molecular Weight 14
NCBI Gene Id 1443
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Chorionic somatomammotropin hormone 2
Alias Symbols PL, CSB, CS-2, GHB1, hCS-B
Peptide Sequence Synthetic peptide located within the following region: LFDHAMLQAHRAHQLAIDTYQEFRLEDGSRRTGQILKQTYSKFDTNSHNH
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a member of the somatotropin/prolactin family of hormones and plays an important role in growth control. The gene is located at the growth hormone locus on chromosome 17 along with four other related genes in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. Although the five genes share a remarkably high degree of sequence identity, they are expressed selectively in different tissues. Alternative splicing generates additional isoforms of each of the five growth hormones. This particular family member is expressed mainly in the placenta and utilizes multiple transcription initiation sites. Expression of the identical mature proteins for chorionic somatomammotropin hormones 1 and 2 is upregulated during development, while the ratio of 1 to 2 increases by term. Structural and expression differences provide avenues for developmental regulation and tissue specificity.
Protein Interactions PTPN12; SMAD9; SMAD4; SMAD3; SMAD2; POLR2A;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CSH2 (ARP52403_P050) antibody
Blocking Peptide For anti-CSH2 (ARP52403_P050) antibody is Catalog # AAP52403 (Previous Catalog # AAPP14347)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CSH2
Uniprot ID B1A4H9
Protein Name Chorionic somatomammotropin hormone Ensembl ENSP00000308396
Protein Accession # NP_072171
Purification Affinity Purified
Nucleotide Accession # NM_022645
Tested Species Reactivity Human
Gene Symbol CSH2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Sheep
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 86%; Goat: 90%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 79%; Rat: 86%; Sheep: 90%
Image 1
Human Placenta
WB Suggested Anti-CSH2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com