CRYGC Antibody - middle region (ARP52388_P050)

Data Sheet
 
Product Number ARP52388_P050
Product Page www.avivasysbio.com/crygc-antibody-middle-region-arp52388-p050.html
Name CRYGC Antibody - middle region (ARP52388_P050)
Protein Size (# AA) 174 amino acids
Molecular Weight 21kDa
NCBI Gene Id 1420
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Crystallin, gamma C
Alias Symbols CCL, CRYG3, CTRCT2
Peptide Sequence Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Leung,T., (er) Mol. Vis. 13, 1333-1338 (2007)
Description of Target Crystallins are the dominant structural components of the vertebrate eye lens.Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Interactions MIP; HSPB2; HSPB1; CRYGD; CRYGC; CRYBB2; CRYAB; CRYAA;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-CRYGC (ARP52388_P050) antibody
Blocking Peptide For anti-CRYGC (ARP52388_P050) antibody is Catalog # AAP52388 (Previous Catalog # AAPP14332)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CRYGC
Uniprot ID P07315
Protein Name Gamma-crystallin C
Sample Type Confirmation

CRYGC is supported by BioGPS gene expression data to be expressed in OVCAR3

Protein Accession # NP_066269
Purification Affinity Purified
Nucleotide Accession # NM_020989
Tested Species Reactivity Human
Gene Symbol CRYGC
Predicted Species Reactivity Human, Rat, Cow, Dog, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Rabbit: 86%; Rat: 79%
Image 1
Human OVCAR-3
WB Suggested Anti-CRYGC Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysateCRYGC is supported by BioGPS gene expression data to be expressed in OVCAR3
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com