Product Number |
ARP52388_P050 |
Product Page |
www.avivasysbio.com/crygc-antibody-middle-region-arp52388-p050.html |
Name |
CRYGC Antibody - middle region (ARP52388_P050) |
Protein Size (# AA) |
174 amino acids |
Molecular Weight |
21kDa |
NCBI Gene Id |
1420 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Crystallin, gamma C |
Alias Symbols |
CCL, CRYG3, CTRCT2 |
Peptide Sequence |
Synthetic peptide located within the following region: GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Leung,T., (er) Mol. Vis. 13, 1333-1338 (2007) |
Description of Target |
Crystallins are the dominant structural components of the vertebrate eye lens.Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Protein Interactions |
MIP; HSPB2; HSPB1; CRYGD; CRYGC; CRYBB2; CRYAB; CRYAA; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-CRYGC (ARP52388_P050) antibody |
Blocking Peptide |
For anti-CRYGC (ARP52388_P050) antibody is Catalog # AAP52388 (Previous Catalog # AAPP14332) |
Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human CRYGC |
Uniprot ID |
P07315 |
Protein Name |
Gamma-crystallin C |
Sample Type Confirmation |
CRYGC is supported by BioGPS gene expression data to be expressed in OVCAR3 |
Protein Accession # |
NP_066269 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_020989 |
Tested Species Reactivity |
Human |
Gene Symbol |
CRYGC |
Predicted Species Reactivity |
Human, Rat, Cow, Dog, Horse, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Rabbit: 86%; Rat: 79% |
Image 1 | Human OVCAR-3
| WB Suggested Anti-CRYGC Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: OVCAR-3 cell lysateCRYGC is supported by BioGPS gene expression data to be expressed in OVCAR3 |
|
|