SPON2 Antibody - middle region (ARP52336_P050)

Data Sheet
 
Product Number ARP52336_P050
Product Page www.avivasysbio.com/spon2-antibody-middle-region-arp52336-p050.html
Name SPON2 Antibody - middle region (ARP52336_P050)
Protein Size (# AA) 331 amino acids
Molecular Weight 36kDa
NCBI Gene Id 10417
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Spondin 2, extracellular matrix protein
Alias Symbols DIL1, DIL-1, MINDIN, M-SPONDIN
Peptide Sequence Synthetic peptide located within the following region: GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Choy,K.W., (2006) Physiol. Genomics 25 (1), 9-15
Description of Target SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens.
Protein Interactions UBC; KRT31;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SPON2 (ARP52336_P050) antibody
Blocking Peptide For anti-SPON2 (ARP52336_P050) antibody is Catalog # AAP52336 (Previous Catalog # AAPS31405)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human SPON2
Uniprot ID Q9BUD6
Protein Name Spondin-2
Protein Accession # NP_036577
Purification Affinity Purified
Nucleotide Accession # NM_012445
Tested Species Reactivity Human
Gene Symbol SPON2
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human Liver
WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com