Product Number |
ARP52335_P050 |
Product Page |
www.avivasysbio.com/spon2-antibody-n-terminal-region-arp52335-p050.html |
Name |
SPON2 Antibody - N-terminal region (ARP52335_P050) |
Protein Size (# AA) |
331 amino acids |
Molecular Weight |
36kDa |
NCBI Gene Id |
10417 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
Spondin 2, extracellular matrix protein |
Alias Symbols |
DIL1, DIL-1, MINDIN, M-SPONDIN |
Peptide Sequence |
Synthetic peptide located within the following region: CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Reference |
Choy,K.W., (2006) Physiol. Genomics 25 (1), 9-15 |
Description of Target |
SPON2 is a cell adhesion protein that promote adhesion and outgrowth of hippocampal embryonic neurons. Binds directly to bacteria and their components and functions as an opsonin for macrophage phagocytosis of bacteria. It is essential in the initiation of the innate immune response and represents a unique pattern-recognition molecule in the ECM for microbial pathogens. |
Protein Interactions |
UBC; KRT31; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-SPON2 (ARP52335_P050) antibody |
Blocking Peptide |
For anti-SPON2 (ARP52335_P050) antibody is Catalog # AAP52335 (Previous Catalog # AAPS31404) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human SPON2 |
Uniprot ID |
Q9BUD6 |
Protein Name |
Spondin-2 |
Protein Accession # |
NP_036577 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_012445 |
Tested Species Reactivity |
Human |
Gene Symbol |
SPON2 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Guinea Pig, Horse, Zebrafish |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100% |
Image 1 | Transfected 293T
| WB Suggested Anti-SPON2 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:312500 Positive Control: Transfected 293T |
|
|