| Product Number |
ARP52321_P050 |
| Product Page |
www.avivasysbio.com/mgll-antibody-n-terminal-region-arp52321-p050.html |
| Name |
MGLL Antibody - N-terminal region (ARP52321_P050) |
| Protein Size (# AA) |
313 amino acids |
| Molecular Weight |
34kDa |
| NCBI Gene Id |
11343 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Monoglyceride lipase |
| Alias Symbols |
MGL, HUK5, MAGL, HU-K5 |
| Peptide Sequence |
Synthetic peptide located within the following region: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGT |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Monoglyceride lipase (MGLL; EC 3.1.1.23) functions together with hormone-sensitive lipase (LIPE; MIM 151750) to hydrolyze intracellular triglyceride stores in adipocytes and other cells to fatty acids and glycerol. MGLL may also complement lipoprotein lipase (LPL; MIM 238600) in completing hydrolysis of monoglycerides resulting from degradation of lipoprotein triglycerides (Karlsson et al., 2001 [PubMed 11470505]). |
| Protein Interactions |
CHGB; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-MGLL (ARP52321_P050) antibody |
| Blocking Peptide |
For anti-MGLL (ARP52321_P050) antibody is Catalog # AAP52321 (Previous Catalog # AAPP44220) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human MGLL |
| Uniprot ID |
Q6IBG9 |
| Protein Name |
Monoglyceride lipase |
| Sample Type Confirmation |
MGLL is supported by BioGPS gene expression data to be expressed in ACHN |
| Protein Accession # |
NP_009214 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_007283 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
MGLL |
| Predicted Species Reactivity |
Human, Mouse, Rat, Dog, Pig, Rabbit |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 79% |
| Image 1 | Human ACHN
 | WB Suggested Anti-MGLL Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysateMGLL is supported by BioGPS gene expression data to be expressed in ACHN |
|
|
