TOMM34 Antibody - N-terminal region (ARP52258_P050)

Data Sheet
 
Product Number ARP52258_P050
Product Page www.avivasysbio.com/tomm34-antibody-n-terminal-region-arp52258-p050.html
Name TOMM34 Antibody - N-terminal region (ARP52258_P050)
Protein Size (# AA) 309 amino acids
Molecular Weight 34kDa
Subunit TOM34
NCBI Gene Id 10953
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Translocase of outer mitochondrial membrane 34
Alias Symbols TOM34, URCC3, HTOM34P
Peptide Sequence Synthetic peptide located within the following region: ALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFS
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is involved in the import of precursor proteins into mitochondria. The encoded protein has a chaperone-like activity, binding the mature portion of unfolded proteins and aiding their import into mitochondria. This protein, which is found in the cytoplasm and sometimes associated with the outer mitochondrial membrane, has a weak ATPase activity and contains 6 TPR repeats.
Protein Interactions CDC37L1; CHORDC1; CDC37; AHSA1; HSP90AB1; UBC; MCM7; HSP90AB2P; TRIM16; HECW2; VCAM1; ITGA4; HSP90AA1; FN1; RBM33; WDR12; ZYX; ZFAND5; DMAP1; ATP6V1D; VCP; PRKAA1; ACD; TINF2; POT1; TERF1; RAB11FIP3;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-TOMM34 (ARP52258_P050) antibody
Blocking Peptide For anti-TOMM34 (ARP52258_P050) antibody is Catalog # AAP52258 (Previous Catalog # AAPP44022)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human TOMM34
Uniprot ID Q15785
Protein Name Mitochondrial import receptor subunit TOM34
Sample Type Confirmation

TOMM34 is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006800
Purification Affinity Purified
Nucleotide Accession # NM_006809
Tested Species Reactivity Human
Gene Symbol TOMM34
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 79%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Image 1
Human HepG2
WB Suggested Anti-TOMM34 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysateTOMM34 is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com