| Product Number |
ARP52240_P050 |
| Product Page |
www.avivasysbio.com/sugt1-antibody-middle-region-arp52240-p050.html |
| Name |
SUGT1 Antibody - middle region (ARP52240_P050) |
| Protein Size (# AA) |
333 amino acids |
| Molecular Weight |
38kDa |
| NCBI Gene Id |
10910 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) |
| Alias Symbols |
SGT1 |
| Peptide Sequence |
Synthetic peptide located within the following region: YTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSF |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
This gene is homologous to the yeast gene SGT1, which encodes a protein involved in kinetochore function and required for the G1/S and G2/M transitions. Complementation studies suggest that the human protein has similar functions. Two transcript variants encoding different isoforms have been found for this gene. |
| Protein Interactions |
CSNK2A1; LRRC40; CACYBP; FKBP8; RNF41; AIP; SKP2; RSU1; HSF4; FKBP5; FKBP4; RPAP3; CEP97; UBC; CFL1; C12orf10; CHORDC1; PMF1; C11orf58; GLRX3; DDX39A; IDH1; LRCH3; LRCH4; BAG3; HDAC11; NLRP4; NOD2; NLRP2; NOD1; HSP90AA1; HSPA8; NR4A1; Itgb1bp2; DSN1; MIS1 |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-SUGT1 (ARP52240_P050) antibody |
| Blocking Peptide |
For anti-SUGT1 (ARP52240_P050) antibody is Catalog # AAP52240 (Previous Catalog # AAPP44001) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human SUGT1 |
| Uniprot ID |
A8K7W3 |
| Protein Name |
cDNA FLJ75780, highly similar to Homo sapiens SGT1, suppressor of G2 allele of SKP1 (SUGT1), mRNA EMBL BAF84817.1 |
| Protein Accession # |
NP_006695 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_006704 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
SUGT1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 86% |
| Image 1 | Human Liver
 | WB Suggested Anti-SUGT1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver |
|
