PPIH Antibody - middle region (ARP52154_P050)

Data Sheet
 
Product Number ARP52154_P050
Product Page www.avivasysbio.com/ppih-antibody-middle-region-arp52154-p050.html
Name PPIH Antibody - middle region (ARP52154_P050)
Protein Size (# AA) 177 amino acids
Molecular Weight 19
NCBI Gene Id 10465
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Peptidylprolyl isomerase H (cyclophilin H)
Alias Symbols CYPH, CYP-20, USA-CYP, SnuCyp-20
Peptide Sequence Synthetic peptide located within the following region: DFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The protein encoded by this gene is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein is a specific component of the complex that includes pre-mRNA processing factors PRPF3, PRPF4, and PRPF18, as well as U4/U5/U6 tri-snRNP. This protein has been shown to possess PPIase activity and may act as a protein chaperone that mediates the interactions between different proteins inside the spliceosome.
Protein Interactions N4BP2L2; HUWE1; UBC; SOX2; METTL18; BAG2; PRPF4; VCAM1; ITGA4; FN1; PAXIP1; PCMT1; PRPF31; PPIH; PRPF3; NHP2L1; CUL3; Prpf8; MEPCE; USP15; SART3; USP4; PRPF18;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-PPIH (ARP52154_P050) antibody
Blocking Peptide For anti-PPIH (ARP52154_P050) antibody is Catalog # AAP52154 (Previous Catalog # AAPP42825)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human PPIH
Uniprot ID O43447
Protein Name Peptidyl-prolyl cis-trans isomerase H
Sample Type Confirmation

PPIH is supported by BioGPS gene expression data to be expressed in HepG2

Protein Accession # NP_006338
Purification Affinity Purified
Nucleotide Accession # NM_006347
Tested Species Reactivity Human
Gene Symbol PPIH
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Goat: 90%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 90%
Image 1
Human HepG2
WB Suggested Anti-PPIH Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysatePPIH is supported by BioGPS gene expression data to be expressed in HepG2
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com