| Product Number |
ARP51938_P050 |
| Product Page |
www.avivasysbio.com/clns1a-antibody-c-terminal-region-arp51938-p050.html |
| Name |
Clns1a Antibody - C-terminal region (ARP51938_P050) |
| Protein Size (# AA) |
241 amino acids |
| Molecular Weight |
27kDa |
| Subunit |
pICln |
| NCBI Gene Id |
12729 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Chloride channel, nucleotide-sensitive, 1A |
| Alias Symbols |
I, Cl, Clci, ICLN, Clcni, 2610036D06Rik, 2610100O04Rik |
| Peptide Sequence |
Synthetic peptide located within the following region: ALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQA |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The function of Clns1a remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Clns1a (ARP51938_P050) antibody |
| Blocking Peptide |
For anti-Clns1a (ARP51938_P050) antibody is Catalog # AAP51938 (Previous Catalog # AAPY03594) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Uniprot ID |
Q923F1 |
| Protein Name |
Chloride channel, nucleotide-sensitive, 1A EMBL AAH05575.3 |
| Protein Accession # |
NP_076160 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_023671 |
| Tested Species Reactivity |
Mouse |
| Gene Symbol |
Clns1a |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 75% |
| Image 1 | Mouse Spleen
 | WB Suggested Anti-Clns1a Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Mouse Spleen |
|
|
