ADA Antibody - middle region (ARP51758_P050)

• Product Number: ARP51758_P050
• Name: ADA Antibody - middle region (ARP51758_P050)
• Protein Size (# AA): 363 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 100
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 0.5 mg/ml
• Gene Full Name: Adenosine deaminase
• Alias Symbols: ADA1
• Peptide Sequence: Synthetic peptide located within the following region: ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Cassani,B., (2008) Blood 111 (8), 4209-4219
• Description of Target: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.This gene encodes an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Protein Interactions: UBC; SGCD; PIAS2; TERF2IP; TINF2; ADORA2B; DPP4; NR3C1; DRD1; GRB2; ADORA2A; ADORA1;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-ADA (ARP51758_P050) antibody is Catalog # AAP51758 (Previous Catalog # AAPY03495)
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ADA
• Uniprot ID: P00813
• Protein Name: Adenosine deaminase
• Protein Accession #: NP_000013
• Purification: Affinity Purified
• Nucleotide Accession #: NM_000022
• Tested Species Reactivity: Human
• Gene Symbol: ADA
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%
• Image 1: Human Muscle
  
  WB Suggested Anti-ADA Antibody Titration: 0.2-1 ug/ml
  ELISA Titer: 1:62500
  Positive Control: Human Muscle