SSX8P Antibody - C-terminal region (ARP51719_P050)

Data Sheet
 
Product Number ARP51719_P050
Product Page www.avivasysbio.com/ssx8p-antibody-c-terminal-region-arp51719-p050.html
Name SSX8P Antibody - C-terminal region (ARP51719_P050)
Protein Size (# AA) 148 amino acids
Molecular Weight 17kDa
NCBI Gene Id 280659
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name SSX family member 8, pseudogene
Alias Symbols SSX8
Peptide Sequence Synthetic peptide located within the following region: MTFGRLQRIIPKIMPKKPAEEGNDSKGVSEASGPQNDGKQLRRPGKSKYF
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-SSX8P (ARP51719_P050) antibody
Blocking Peptide For anti-SSX8P (ARP51719_P050) antibody is Catalog # AAP51719 (Previous Catalog # AAPY02537)
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human SSX8
Uniprot ID Q7RTT4
Protein Accession # NP_777621
Purification Affinity Purified
Nucleotide Accession # NM_174961
Tested Species Reactivity Human
Gene Symbol SSX8P
Predicted Species Reactivity Human
Application WB
Predicted Homology Based on Immunogen Sequence Human: 86%
Image 1
Human Liver
WB Suggested Anti-SSX8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Liver
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com