Product Number |
ARP51708_P050 |
Product Page |
www.avivasysbio.com/depdc7-antibody-n-terminal-region-arp51708-p050.html |
Name |
DEPDC7 Antibody - N-terminal region (ARP51708_P050) |
Protein Size (# AA) |
502 amino acids |
Molecular Weight |
58 |
NCBI Gene Id |
91614 |
Host |
Rabbit |
Clonality |
Polyclonal |
Concentration |
0.5 mg/ml |
Gene Full Name |
DEP domain containing 7 |
Alias Symbols |
TR2, dJ85M6.4 |
Peptide Sequence |
Synthetic peptide located within the following region: FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD |
Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Description of Target |
The exact function of DEPDC7 remains unknown. |
Protein Interactions |
GTF2B; ISG15; UBC; |
Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Datasheets/Manuals |
Printable datasheet for anti-DEPDC7 (ARP51708_P050) antibody |
Blocking Peptide |
For anti-DEPDC7 (ARP51708_P050) antibody is Catalog # AAP51708 (Previous Catalog # AAPP40219) |
Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human DEPDC7 |
Uniprot ID |
Q95JW3 |
Protein Name |
DEP domain-containing protein 7 |
Protein Accession # |
NP_631899 |
Purification |
Affinity Purified |
Nucleotide Accession # |
NM_139160 |
Tested Species Reactivity |
Human |
Gene Symbol |
DEPDC7 |
Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Application |
WB |
Predicted Homology Based on Immunogen Sequence |
Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 100% |
Image 1 | Human NCI-H226
| WB Suggested Anti-DEPDC7 Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:1562500 Positive Control: NCI-H226 cell lysate |
|
|