DEPDC7 Antibody - N-terminal region (ARP51708_P050)

Data Sheet
 
Product Number ARP51708_P050
Product Page www.avivasysbio.com/depdc7-antibody-n-terminal-region-arp51708-p050.html
Name DEPDC7 Antibody - N-terminal region (ARP51708_P050)
Protein Size (# AA) 502 amino acids
Molecular Weight 58
NCBI Gene Id 91614
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name DEP domain containing 7
Alias Symbols TR2, dJ85M6.4
Peptide Sequence Synthetic peptide located within the following region: FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Description of Target The exact function of DEPDC7 remains unknown.
Protein Interactions GTF2B; ISG15; UBC;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-DEPDC7 (ARP51708_P050) antibody
Blocking Peptide For anti-DEPDC7 (ARP51708_P050) antibody is Catalog # AAP51708 (Previous Catalog # AAPP40219)
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human DEPDC7
Uniprot ID Q95JW3
Protein Name DEP domain-containing protein 7
Protein Accession # NP_631899
Purification Affinity Purified
Nucleotide Accession # NM_139160
Tested Species Reactivity Human
Gene Symbol DEPDC7
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 100%
Image 1
Human NCI-H226
WB Suggested Anti-DEPDC7 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: NCI-H226 cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
10211 Pacific Mesa Blvd, Ste 401, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com