INTS4 Antibody - middle region (ARP51694_P050)

Data Sheet
 
Product Number ARP51694_P050
Product Page www.avivasysbio.com/ints4-antibody-middle-region-arp51694-p050.html
Name INTS4 Antibody - middle region (ARP51694_P050)
Protein Size (# AA) 963 amino acids
Molecular Weight 108kDa
Subunit 4
NCBI Gene Id 92105
Host Rabbit
Clonality Polyclonal
Concentration 0.5 mg/ml
Gene Full Name Integrator complex subunit 4
Alias Symbols INT4, MST093
Peptide Sequence Synthetic peptide located within the following region: PAEVVKILQTMLRQSAFLHLPLPEQIHKASATIIEPAGESDNPLRFTSGL
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reference Baillat,D., (2005) Cell 123 (2), 265-276
Description of Target INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS4 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A; MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1; MIM 180680) and U2 (RNU2; MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM].
Protein Interactions USHBP1; ZMIZ2; HGS; UBC; HECW2; INTS9; UBD; SUMO2; INTS10; SHFM1; INTS5; INTS3; INTS6; INTS1; RPAP2; KIAA0513;
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Datasheets/Manuals Printable datasheet for anti-INTS4 (ARP51694_P050) antibody
Blocking Peptide For anti-INTS4 (ARP51694_P050) antibody is Catalog # AAP51694 (Previous Catalog # AAPP14115)
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human INTS4
Uniprot ID Q96HW7
Protein Name Integrator complex subunit 4
Protein Accession # NP_291025
Purification Affinity Purified
Nucleotide Accession # NM_033547
Tested Species Reactivity Human
Gene Symbol INTS4
Predicted Species Reactivity Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Application WB
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Image 1
Human HeLa
WB Suggested Anti-INTS4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Hela cell lysate
 

AVIVA SYSTEMS BIOLOGY manufactures and sells quality antibody products covering genome wide proteins.

AVIVA SYSTEMS BIOLOGY
6370 Nancy Ridge Dr., Suite 104, San Diego, CA 92121 USA | Tel: (858)552-6979 | info@avivasysbio.com