| Product Number |
ARP51293_P050 |
| Product Page |
www.avivasysbio.com/p2ry1-antibody-n-terminal-region-arp51293-p050.html |
| Name |
P2RY1 Antibody - N-terminal region (ARP51293_P050) |
| Protein Size (# AA) |
373 amino acids |
| Molecular Weight |
42kDa |
| NCBI Gene Id |
5028 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Purinergic receptor P2Y, G-protein coupled, 1 |
| Alias Symbols |
P2Y1, SARCC |
| Peptide Sequence |
Synthetic peptide located within the following region: VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Staritz,P., (er) Int. J. Cardiol. (2008) In press |
| Description of Target |
The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor functions as a receptor for extracellular ATP and ADP. In platelets binding to ADP leads to mobilization of intracellular calcium ions via activation of phospholipase C, a change in platelet shape, and probably to platelet aggregation. [provided by RefSeq, Jul 2008]. |
| Protein Interactions |
SLC9A3R2; SLC9A3R1; ADORA1; |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP51293_P050 |
| Blocking Peptide |
Catalog # AAP51293 (Previous Catalog # AAPS23205) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human P2RY1 |
| Uniprot ID |
P47900 |
| Protein Name |
P2Y purinoceptor 1 |
| Publications |
Dilip, R. et al. Distribution and development of P2Y1-purinoceptors in the mouse retina. J. Mol. Histol. 44, 639-44 (2013). 23907621 |
| Protein Accession # |
NP_002554 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_002563.2 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
P2RY1 |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92% |
| Image 1 | Human Fetal Muscle
 | WB Suggested Anti-P2RY1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Fetal Muscle |
|
| Image 2 | Human liver, Hek293 cells
 | WB Suggested Anti-P2RY1 Antibody Titration: 1 ug/ml
Positive Control: Human liver, HEK293 cells |
|
