PHF6 Antibody - N-terminal region (ARP51237_T100)

• Product Number: ARP51237_T100
• Name: PHF6 Antibody - N-terminal region (ARP51237_T100)
• Protein Size (# AA): 365 amino acids
• Molecular Weight: 41kDa
• NCBI Gene Id: 84295
• Host: Rabbit
• Clonality: Polyclonal
• Concentration: 1.0 mg/ml
• Gene Full Name: PHD finger protein 6
• Alias Symbols: BFLS, BORJ, CENP-31
• Peptide Sequence: Synthetic peptide located within the following region: VGQNHSEDGAPALLTTAPPPGLQPGAGGTPGGPGGGGAPPRYATLEHPFH
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Reference: Vallee,D., (2004) J. Med. Genet. 41 (10), 778-783
• Description of Target: PHF6 is a member of the plant homeodomain (PHD)-like finger (PHF) family. PHF6 is a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation that localizes to the nucleolus. Mutations affecting the coding region of its gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears.This gene is a member of the plant homeodomain (PHD)-like finger (PHF) family. It encodes a protein with two PHD-type zinc finger domains, indicating a potential role in transcriptional regulation, that localizes to the nucleolus. Mutations affecting the coding region of this gene or the splicing of the transcript have been associated with Borjeson-Forssman-Lehmann syndrome (BFLS), a disorder characterized by mental retardation, epilepsy, hypogonadism, hypometabolism, obesity, swelling of subcutaneous tissue of the face, narrow palpebral fissures, and large ears. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Protein Interactions: UBC; SUMO1; NEDD8; BMI1; HECW2; CAND1; CUL3; HDGF;
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Blocking Peptide: For anti-PHF6 (ARP51237_T100) antibody is Catalog # AAP51237 (Previous Catalog # AAPP28308)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHF6
• Uniprot ID: Q8IWS0
• Protein Name: PHD finger protein 6
• Protein Accession #: NP_115834
• Purification: Protein A purified
• Nucleotide Accession #: NM_032458
• Tested Species Reactivity: Human
• Gene Symbol: PHF6
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Application: WB
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 100%
• Image 1: Human Jurkat
  
  WB Suggested Anti-PHF6 Antibody Titration: 5.0ug/ml
  Positive Control: Jurkat cell lysate
• Image 2: Human, Mouse
  
  Sample Type: HEK293T cells transfected with a plasmid for over expression of myc-tagged PHF6Primary Dilution: 1:1000Secondary (goat anti-rabbit HRP) Dilution: 1:1000