| Product Number |
ARP51215_P050 |
| Product Page |
www.avivasysbio.com/fxn-antibody-c-terminal-region-arp51215-p050.html |
| Name |
Fxn Antibody - C-terminal region (ARP51215_P050) |
| Protein Size (# AA) |
208 amino acids |
| Molecular Weight |
23kDa |
| NCBI Gene Id |
499335 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Frataxin |
| Alias Symbols |
RGD1565754 |
| Peptide Sequence |
Synthetic peptide located within the following region: EFFEDLADKPYTLKDYDVSFGDGVLTIKLGGDLGTYVINKQTPNKQIWLS |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Fxn modulates the RNA-binding activity of ACO1. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-Fxn (ARP51215_P050) antibody |
| Blocking Peptide |
For anti-Fxn (ARP51215_P050) antibody is Catalog # AAP51215 (Previous Catalog # AAPP28083) |
| Immunogen |
The immunogen is a synthetic peptide corresponding to a region of Rat |
| Uniprot ID |
D3ZYW7 |
| Protein Name |
Frataxin, mitochondrial |
| Protein Accession # |
XP_001078791 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_001191952 |
| Tested Species Reactivity |
Rat |
| Gene Symbol |
Fxn |
| Predicted Species Reactivity |
Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 92% |
| Image 1 | Rat Heart
 | WB Suggested Anti-Fxn Antibody
Titration: 1.0 ug/ml
Positive Control: Rat Heart |
|
|
