| Product Number |
ARP51185_P050 |
| Product Page |
www.avivasysbio.com/lcn6-antibody-middle-region-arp51185-p050.html |
| Name |
LCN6 Antibody - middle region (ARP51185_P050) |
| Protein Size (# AA) |
163 amino acids |
| Molecular Weight |
18kDa |
| NCBI Gene Id |
158062 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Lipocalin 6 |
| Alias Symbols |
LCN5, hLcn5, UNQ643 |
| Peptide Sequence |
Synthetic peptide located within the following region: LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reference |
Suzuki,K., Gene 339, 49-59 (2004) |
| Description of Target |
LCN6 may play a role in male fertility. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for ARP51185_P050 |
| Blocking Peptide |
Catalog # AAP51185 (Previous Catalog # AAPP28212) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LCN6 |
| Uniprot ID |
P62502 |
| Protein Name |
Epididymal-specific lipocalin-6 |
| Protein Accession # |
NP_945184 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
NM_198946 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
LCN6 |
| Predicted Species Reactivity |
Human, Dog |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Dog: 86%; Human: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-LCN6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate |
|
|
