| Product Number |
ARP51009_P050 |
| Product Page |
www.avivasysbio.com/foxi3-antibody-middle-region-arp51009-p050.html |
| Name |
FOXI3 Antibody - middle region (ARP51009_P050) |
| Protein Size (# AA) |
393 amino acids |
| Molecular Weight |
41kDa |
| NCBI Gene Id |
344167 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
Forkhead box I3 |
| Alias Symbols |
- |
| Peptide Sequence |
Synthetic peptide located within the following region: QGAQLPSSGVFSPTSISEASADTLQLSNSTSNSTGQRSSYYSPFPASTSG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Description of Target |
The exact function of LOC344167 remains unknown. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-FOXI3 (ARP51009_P050) antibody |
| Blocking Peptide |
For anti-FOXI3 (ARP51009_P050) antibody is Catalog # AAP51009 (Previous Catalog # AAPP14022) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the middle region of human LOC344167 |
| Uniprot ID |
A8MTJ6 |
| Protein Accession # |
XP_001126001 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001126001 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
FOXI3 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human HepG2
 | WB Suggested Anti-FOXI3 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate |
|
|
