| Product Number |
ARP50975_P050 |
| Product Page |
www.avivasysbio.com/znf724-antibody-n-terminal-region-arp50975-p050.html |
| Name |
ZNF724 Antibody - N-terminal region (ARP50975_P050) |
| Protein Size (# AA) |
679 amino acids |
| Molecular Weight |
77kDa |
| NCBI Gene Id |
440519 |
| Host |
Rabbit |
| Clonality |
Polyclonal |
| Concentration |
0.5 mg/ml |
| Gene Full Name |
zinc finger protein 724 |
| Alias Symbols |
ZNF724P |
| Peptide Sequence |
Synthetic peptide located within the following region: KGSYNGFNQCLTTTQSKIFQCDKYVKDFHKFSNSNRHKTEKNPFKCKECG |
| Product Format |
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Reconstitution and Storage |
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Datasheets/Manuals |
Printable datasheet for anti-ZNF724 (ARP50975_P050) antibody |
| Blocking Peptide |
For anti-ZNF724 (ARP50975_P050) antibody is Catalog # AAP50975 (Previous Catalog # AAPP29982) |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF724P |
| Uniprot ID |
A8MTY0 |
| Protein Name |
zinc finger protein 724 |
| Protein Accession # |
XP_001132303 |
| Purification |
Affinity Purified |
| Nucleotide Accession # |
XM_001132303 |
| Tested Species Reactivity |
Human |
| Gene Symbol |
ZNF724 |
| Predicted Species Reactivity |
Human |
| Application |
WB |
| Predicted Homology Based on Immunogen Sequence |
Human: 100% |
| Image 1 | Human 721_B
 | WB Suggested Anti-ZNF724P Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate |
|
|
